Lineage for d1tkcb2 (1tkc B:338-534)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312976Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 312977Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 313030Family c.36.1.6: TK-like Pyr module [88735] (2 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 313035Protein Transketolase (TK), Pyr module [88736] (3 species)
  7. 313036Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88737] (7 PDB entries)
  8. 313048Domain d1tkcb2: 1tkc B:338-534 [31814]
    Other proteins in same PDB: d1tkca1, d1tkca3, d1tkcb1, d1tkcb3
    complexed with ca, m6t

Details for d1tkcb2

PDB Entry: 1tkc (more details), 2.7 Å

PDB Description: specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate

SCOP Domain Sequences for d1tkcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkcb2 c.36.1.6 (B:338-534) Transketolase (TK), Pyr module {Baker's yeast (Saccharomyces cerevisiae)}
lpanwesklptytakdsavatrklsetvledvynqlpeliggsadltpsnltrwkealdf
qppssgsgnysgryirygirehamgaimngisafganykpyggtflnfvsyaagavrlsa
lsghpviwvathdsigvgedgpthqpietlahfrslpniqvwrpadgnevsaayknsles
khtpsiialsrqnlpql

SCOP Domain Coordinates for d1tkcb2:

Click to download the PDB-style file with coordinates for d1tkcb2.
(The format of our PDB-style files is described here.)

Timeline for d1tkcb2: