Lineage for d5azpa_ (5azp A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2251857Fold f.5: Outer membrane efflux proteins (OEP) [56953] (1 superfamily)
    subunit fold contains tandem repeat of alpha-beta hairpin-alpha(2) motif
    trimeric fold contains barrel (n=12, S=18) formed by beta-hairpins, two from each subunit, and a bundle of helices with a channel running through it
  4. 2251858Superfamily f.5.1: Outer membrane efflux proteins (OEP) [56954] (2 families) (S)
  5. 2251887Family f.5.1.0: automated matches [227266] (1 protein)
    not a true family
  6. 2251888Protein automated matches [227059] (4 species)
    not a true protein
  7. 2251896Species Pseudomonas aeruginosa [TaxId:208964] [318062] (5 PDB entries)
  8. 2251897Domain d5azpa_: 5azp A: [318133]
    Other proteins in same PDB: d5azpb2
    automated match to d1wp1b_
    complexed with 3pk, act, bog, fmt, gol, na, oya

Details for d5azpa_

PDB Entry: 5azp (more details), 1.69 Å

PDB Description: crystal structure of a membrane protein from pseudomonas aeruginosa
PDB Compounds: (A:) Multidrug efflux outer membrane protein OprN

SCOPe Domain Sequences for d5azpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5azpa_ f.5.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
ctvgpdyrtpdtaaakidataskpydrsrfeslwwkqfddptlnqlveqslsgnrdlrva
farlraaralrddvandrfpvvtsrasadigkgqqpgvtedrvnserydlgldsaweldl
fgrirrqlessdalseaaeadlqqlqvsliaelvdaygqlrgaqlrekialsnlenqkes
rqlteqlrdagvgaeldvlradarlaataasvpqlqaeaerarhriatllgqrpeeltvd
lsprdlpaitkalpigdpgellrrrpdiraaerrlaastadvgvatadlfprvslsgflg
ftagrgsqigssaarawsvgpsiswaafdlgsvrarlrgakadadaalasyeqqvllale
esanafsdygkrqerlvslvrqseasraaaqqaairyregttdflvlldaereqlsaeda
qaqaevelyrgivaiyrslgggwqps

SCOPe Domain Coordinates for d5azpa_:

Click to download the PDB-style file with coordinates for d5azpa_.
(The format of our PDB-style files is described here.)

Timeline for d5azpa_: