Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) |
Family c.1.1.0: automated matches [191424] (1 protein) not a true family |
Protein automated matches [190605] (21 species) not a true protein |
Species Thermoplasma acidophilum [TaxId:273075] [318086] (2 PDB entries) |
Domain d5cssc_: 5css C: [318129] automated match to d2h6ra_ complexed with cl, g3p |
PDB Entry: 5css (more details), 2.17 Å
SCOPe Domain Sequences for d5cssc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cssc_ c.1.1.0 (C:) automated matches {Thermoplasma acidophilum [TaxId: 273075]} mytaivnlktyreatganftrfmekfepvqgkfelifspslldlekaakcgkfrffaqhv daepygaytghvpmdmmidlgitgsilnhserrlprdtiintlkkaskldftivlcvena eeakyfreyepdfiayeprdliggdvsvstakpeiiedivkiyegtgtsvlvgagiktge dvrrsiglgargilvasgvvksadptkslnslie
Timeline for d5cssc_: