SCOPe 2.06: Domain d5csrb_: 5csr B:

Lineage for d5csrb_ (5csr B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.0: automated matches [191424] (1 protein)
   not a true family

6. Protein automated matches [190605] (21 species)
   not a true protein

7. Species Thermoplasma acidophilum [TaxId:273075] [318086] (2 PDB entries)

8. Domain d5csrb_: 5csr B: [318128]
   Other proteins in same PDB: d5csrc2, d5csrd2
   automated match to d2h6ra_
   complexed with cl, gol

Details for d5csrb_

PDB Entry: 5csr, 1.94 Å

PDB Description: crystal structure of triosephosphate isomerase from thermoplasma acidophilium

PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d5csrb_:

Sequence; same for both SEQRES and ATOM records:

>d5csrb_ c.1.1.0 (B:) automated matches {Thermoplasma acidophilum [TaxId: 273075]}
mytaivnlktyreatganftrfmekfepvqgkfelifspslldlekaakcgkfrffaqhv
daepygaytghvpmdmmidlgitgsilnhserrlprdtiintlkkaskldftivlcvena
eeakyfreyepdfiayeprdliggdvsvstakpeiiedivkiyegtgtsvlvgagiktge
dvrrsiglgargilvasgvvksadptkslnsliel

Timeline for d5csrb_:

• d5csrb_ is new in SCOPe 2.06-stable
  
• d5csrb_ appears in SCOPe 2.07
  
• d5csrb_ appears in the current release, SCOPe 2.08