Lineage for d5cssd_ (5css D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2434696Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2435148Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2435149Protein automated matches [190605] (25 species)
    not a true protein
  7. 2435283Species Thermoplasma acidophilum [TaxId:273075] [318086] (2 PDB entries)
  8. 2435291Domain d5cssd_: 5css D: [318116]
    automated match to d2h6ra_
    complexed with cl, g3p

Details for d5cssd_

PDB Entry: 5css (more details), 2.17 Å

PDB Description: crystal structure of triosephosphate isomerase from thermoplasma acidophilum with glycerol 3-phosphate
PDB Compounds: (D:) triosephosphate isomerase

SCOPe Domain Sequences for d5cssd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cssd_ c.1.1.0 (D:) automated matches {Thermoplasma acidophilum [TaxId: 273075]}
mytaivnlktyreatganftrfmekfepvqgkfelifspslldlekaakcgkfrffaqhv
daepygaytghvpmdmmidlgitgsilnhserrlprdtiintlkkaskldftivlcvena
eeakyfreyepdfiayeprdliggdvsvstakpeiiedivkiyegtgtsvlvgagiktge
dvrrsiglgargilvasgvvksadptkslnslie

SCOPe Domain Coordinates for d5cssd_:

Click to download the PDB-style file with coordinates for d5cssd_.
(The format of our PDB-style files is described here.)

Timeline for d5cssd_: