SCOPe 2.08: Domain d5em0a1: 5em0 A:2-133

Lineage for d5em0a1 (5em0 A:2-133)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families)
   alpha-beta(2)-alpha-beta(5)-alpha

5. Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
   automatically mapped to Pfam PF00235

6. Protein automated matches [190412] (11 species)
   not a true protein

7. Species Artemisia vulgaris [TaxId:4220] [318111] (2 PDB entries)

8. Domain d5em0a1: 5em0 A:2-133 [318112]
   Other proteins in same PDB: d5em0a2
   automated match to d1cqaa_
   complexed with epe, na

Details for d5em0a1

PDB Entry: 5em0, 1.1 Å

PDB Description: crystal structure of mugwort allergen art v 4

PDB Compounds: (A:) Pollen allergen Art v 4.01

SCOPe Domain Sequences for d5em0a1:

Sequence; same for both SEQRES and ATOM records:

>d5em0a1 d.110.1.1 (A:2-133) automated matches {Artemisia vulgaris [TaxId: 4220]}
swqtyvddhlmcdiegtgqhltsaaifgtdgtvwaksasfpefkpneidaiikefneagq
laptglflggakymviqgeagavirgkkgaggicikktgqamvfgiydepvapgqcnmvv
erlgdylldqgm

Timeline for d5em0a1:

• d5em0a1 first appeared in SCOPe 2.06
  
• d5em0a1 appears in SCOPe 2.07