Lineage for d1tkca1 (1tkc A:3-337)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22854Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 22855Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 22895Family c.36.1.2: Transketolase, TK [52528] (1 protein)
  6. 22896Protein Transketolase, TK [52529] (1 species)
  7. 22897Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52530] (6 PDB entries)
  8. 22914Domain d1tkca1: 1tkc A:3-337 [31811]
    Other proteins in same PDB: d1tkca3, d1tkcb3

Details for d1tkca1

PDB Entry: 1tkc (more details), 2.7 Å

PDB Description: specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate

SCOP Domain Sequences for d1tkca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkca1 c.36.1.2 (A:3-337) Transketolase, TK {Baker's yeast (Saccharomyces cerevisiae)}
qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
kpgveannkwnklfseyqkkfpelgaelarrlsgq

SCOP Domain Coordinates for d1tkca1:

Click to download the PDB-style file with coordinates for d1tkca1.
(The format of our PDB-style files is described here.)

Timeline for d1tkca1: