SCOPe 2.08: Domain d5em3a1: 5em3 A:626-739

Lineage for d5em3a1 (5em3 A:626-739)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d5em3a1: 5em3 A:626-739 [318102]
   Other proteins in same PDB: d5em3a2
   automated match to d4lc2a_
   protein/DNA complex; complexed with 5q0, no3

Details for d5em3a1

PDB Entry: 5em3, 1.4 Å

PDB Description: crystal structure of the human brpf1 bromodomain in complex with seed9

PDB Compounds: (A:) Peregrin

SCOPe Domain Sequences for d5em3a1:

Sequence; same for both SEQRES and ATOM records:

>d5em3a1 a.29.2.0 (A:626-739) automated matches {Human (Homo sapiens) [TaxId: 9606]}
memqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleay
rylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekm

Timeline for d5em3a1:

• d5em3a1 first appeared in SCOPe 2.06
  
• d5em3a1 appears in SCOPe 2.07