| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.6: TK-like Pyr module [88735] (2 proteins) different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain |
| Protein Transketolase (TK), Pyr module [88736] (3 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88737] (7 PDB entries) |
| Domain d1tkbb2: 1tkb B:338-534 [31810] Other proteins in same PDB: d1tkba1, d1tkba3, d1tkbb1, d1tkbb3 complexed with ca, n1t |
PDB Entry: 1tkb (more details), 2.3 Å
SCOP Domain Sequences for d1tkbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tkbb2 c.36.1.6 (B:338-534) Transketolase (TK), Pyr module {Baker's yeast (Saccharomyces cerevisiae)}
lpanwesklptytakdsavatrklsetvledvynqlpeliggsadltpsnltrwkealdf
qppssgsgnysgryirygirehamgaimngisafganykpyggtflnfvsyaagavrlsa
lsghpviwvathdsigvgedgpthqpietlahfrslpniqvwrpadgnevsaayknsles
khtpsiialsrqnlpql
Timeline for d1tkbb2: