SCOPe 2.08: Domain d5ca6a_: 5ca6 A:

Lineage for d5ca6a_ (5ca6 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins)
   automatically mapped to Pfam PF00426

6. Protein automated matches [190699] (4 species)
   not a true protein

7. Species Porcine rotavirus (serotype 5 / strain tfr-41) [TaxId:31581] [318090] (1 PDB entry)

8. Domain d5ca6a_: 5ca6 A: [318099]
   automated match to d2p3ka_
   complexed with fmt, gol, plm, vca

Details for d5ca6a_

PDB Entry: 5ca6, 1.9 Å

PDB Description: crystallographic structure of apo porcine rotavirus tfr-41 vp8*

PDB Compounds: (A:) porcine rotavirus TFR-41 VP8*

SCOPe Domain Sequences for d5ca6a_:

Sequence; same for both SEQRES and ATOM records:

>d5ca6a_ b.29.1.14 (A:) automated matches {Porcine rotavirus (serotype 5 / strain tfr-41) [TaxId: 31581]}
gpyqpttvnpptsywillaptiegvivqgtnntdrwlatiliepnvqatdriynlfgqqv
tlsventsqtqwkfidvskttptgnytqhgplfstpklyavmkfsgriytyngttpnatt
gyysttnydtvnmtsfcdfyliprnqeekcaeyinhgl

Timeline for d5ca6a_:

• d5ca6a_ first appeared in SCOPe 2.06
  
• d5ca6a_ appears in SCOPe 2.07