| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) ![]() alpha-beta(2)-alpha-beta(5)-alpha |
| Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins) automatically mapped to Pfam PF00235 |
| Protein automated matches [190412] (11 species) not a true protein |
| Species Ambrosia artemisiifolia [TaxId:4212] [318094] (1 PDB entry) |
| Domain d5em1a1: 5em1 A:2-133 [318095] Other proteins in same PDB: d5em1a2 automated match to d1cqaa_ complexed with bez, cl |
PDB Entry: 5em1 (more details), 1.45 Å
SCOPe Domain Sequences for d5em1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5em1a1 d.110.1.1 (A:2-133) automated matches {Ambrosia artemisiifolia [TaxId: 4212]}
swqtyvdehlmcdiegtgqhlasaaifgtdgnvwaksssfpefkpdeinaiikefsepga
laptglflagakymviqgepgavirgkkgaggicikktgqamvfgiyeepvnpgqcnmvv
erlgdylvdqgm
Timeline for d5em1a1: