Lineage for d5em1a1 (5em1 A:2-133)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970039Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 2970040Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
    automatically mapped to Pfam PF00235
  6. 2970082Protein automated matches [190412] (11 species)
    not a true protein
  7. 2970083Species Ambrosia artemisiifolia [TaxId:4212] [318094] (1 PDB entry)
  8. 2970084Domain d5em1a1: 5em1 A:2-133 [318095]
    Other proteins in same PDB: d5em1a2
    automated match to d1cqaa_
    complexed with bez, cl

Details for d5em1a1

PDB Entry: 5em1 (more details), 1.45 Å

PDB Description: crystal structure of ragweed allergen amb a 8
PDB Compounds: (A:) Profilin

SCOPe Domain Sequences for d5em1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5em1a1 d.110.1.1 (A:2-133) automated matches {Ambrosia artemisiifolia [TaxId: 4212]}
swqtyvdehlmcdiegtgqhlasaaifgtdgnvwaksssfpefkpdeinaiikefsepga
laptglflagakymviqgepgavirgkkgaggicikktgqamvfgiyeepvnpgqcnmvv
erlgdylvdqgm

SCOPe Domain Coordinates for d5em1a1:

Click to download the PDB-style file with coordinates for d5em1a1.
(The format of our PDB-style files is described here.)

Timeline for d5em1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5em1a2