![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Rotavirus a (strain human/japan/k8/1977 g1-p3a[9]-ix-rx-cx-mx-a1-nx-tx-ex-h3) [TaxId:39012] [318080] (2 PDB entries) |
![]() | Domain d5caza_: 5caz A: [318092] automated match to d2p3ka_ complexed with gol, ipa, so4 |
PDB Entry: 5caz (more details), 1.8 Å
SCOPe Domain Sequences for d5caza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5caza_ b.29.1.0 (A:) automated matches {Rotavirus a (strain human/japan/k8/1977 g1-p3a[9]-ix-rx-cx-mx-a1-nx-tx-ex-h3) [TaxId: 39012]} tldgpyqptslnlpvdywmliaptregkvaegtnttdrwfacvlvepnvqntqrqyvldg qnvqlhvsndsstswkfilfikltpdgtytqystlstphklcawmkrdnrvywyqgatpn asesyyltinndnsnvssdaefylipqsqtamctqyinngl
Timeline for d5caza_: