Lineage for d5caza_ (5caz A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781259Species Rotavirus a (strain human/japan/k8/1977 g1-p3a[9]-ix-rx-cx-mx-a1-nx-tx-ex-h3) [TaxId:39012] [318080] (2 PDB entries)
  8. 2781262Domain d5caza_: 5caz A: [318092]
    automated match to d2p3ka_
    complexed with gol, ipa, so4

Details for d5caza_

PDB Entry: 5caz (more details), 1.8 Å

PDB Description: crystallographic structure of apo human rotavirus k8 vp8*
PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d5caza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5caza_ b.29.1.0 (A:) automated matches {Rotavirus a (strain human/japan/k8/1977 g1-p3a[9]-ix-rx-cx-mx-a1-nx-tx-ex-h3) [TaxId: 39012]}
tldgpyqptslnlpvdywmliaptregkvaegtnttdrwfacvlvepnvqntqrqyvldg
qnvqlhvsndsstswkfilfikltpdgtytqystlstphklcawmkrdnrvywyqgatpn
asesyyltinndnsnvssdaefylipqsqtamctqyinngl

SCOPe Domain Coordinates for d5caza_:

Click to download the PDB-style file with coordinates for d5caza_.
(The format of our PDB-style files is described here.)

Timeline for d5caza_: