![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins) automatically mapped to Pfam PF00426 |
![]() | Protein automated matches [190699] (4 species) not a true protein |
![]() | Species Porcine rotavirus (serotype 5 / strain tfr-41) [TaxId:31581] [318090] (1 PDB entry) |
![]() | Domain d5ca6b_: 5ca6 B: [318091] automated match to d2p3ka_ complexed with fmt, gol, plm, vca |
PDB Entry: 5ca6 (more details), 1.9 Å
SCOPe Domain Sequences for d5ca6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ca6b_ b.29.1.14 (B:) automated matches {Porcine rotavirus (serotype 5 / strain tfr-41) [TaxId: 31581]} lggpyqpttvnpptsywillaptiegvivqgtnntdrwlatiliepnvqatdriynlfgq qvtlsventsqtqwkfidvskttptgnytqhgplfstpklyavmkfsgriytyngttpna ttgyysttnydtvnmtsfcdfyliprnqeekcaeyinhgl
Timeline for d5ca6b_: