Lineage for d5cssa_ (5css A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413228Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2413631Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2413632Protein automated matches [190605] (21 species)
    not a true protein
  7. 2413743Species Thermoplasma acidophilum [TaxId:273075] [318086] (2 PDB entries)
  8. 2413748Domain d5cssa_: 5css A: [318088]
    automated match to d2h6ra_
    complexed with cl, g3p

Details for d5cssa_

PDB Entry: 5css (more details), 2.17 Å

PDB Description: crystal structure of triosephosphate isomerase from thermoplasma acidophilum with glycerol 3-phosphate
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d5cssa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cssa_ c.1.1.0 (A:) automated matches {Thermoplasma acidophilum [TaxId: 273075]}
mytaivnlktyreatganftrfmekfepvqgkfelifspslldlekaakcgkfrffaqhv
daepygaytghvpmdmmidlgitgsilnhserrlprdtiintlkkaskldftivlcvena
eeakyfreyepdfiayeprdliggdvsvstakpeiiedivkiyegtgtsvlvgagiktge
dvrrsiglgargilvasgvvksadptkslnslie

SCOPe Domain Coordinates for d5cssa_:

Click to download the PDB-style file with coordinates for d5cssa_.
(The format of our PDB-style files is described here.)

Timeline for d5cssa_: