SCOPe 2.08: Domain d5buxb_: 5bux B:

Lineage for d5buxb_ (5bux B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (42 species)
   not a true protein

7. Species Yersinia pestis [TaxId:187410] [226504] (3 PDB entries)

8. Domain d5buxb_: 5bux B: [318085]
   automated match to d4h4ge_
   complexed with gol, scn

Details for d5buxb_

PDB Entry: 5bux, 1.9 Å

PDB Description: crystal structure of 3-hydroxyacyl-acp dehydratase (fabz) from yersinia pestis with glycerol bound

PDB Compounds: (B:) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ

SCOPe Domain Sequences for d5buxb_:

Sequence; same for both SEQRES and ATOM records:

>d5buxb_ d.38.1.0 (B:) automated matches {Yersinia pestis [TaxId: 187410]}
thtlhieeildllphrfpfllvdrvldfeegkflravknvsfnepffqghfpgkpifpgv
lileamaqatgilafksrgklepgelyyfagidearfkrpvvpgdqmimevefvkerrgl
trftgvakvdgeivctatmmcar

Timeline for d5buxb_:

• d5buxb_ first appeared in SCOPe 2.06
  
• d5buxb_ appears in SCOPe 2.07