SCOPe 2.08: Domain d5cb7b_: 5cb7 B:

Lineage for d5cb7b_ (5cb7 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Rotavirus a (strain human/japan/k8/1977 g1-p3a[9]-ix-rx-cx-mx-a1-nx-tx-ex-h3) [TaxId:39012] [318080] (2 PDB entries)

8. Domain d5cb7b_: 5cb7 B: [318083]
   automated match to d2p3ka_
   complexed with a2g, cl, fuc, gal, gol

Details for d5cb7b_

PDB Entry: 5cb7, 1.35 Å

PDB Description: crystallographic structure of human rotavirus k8 vp8* in complex with a-type hbga

PDB Compounds: (B:) Outer capsid protein VP4

SCOPe Domain Sequences for d5cb7b_:

Sequence; same for both SEQRES and ATOM records:

>d5cb7b_ b.29.1.0 (B:) automated matches {Rotavirus a (strain human/japan/k8/1977 g1-p3a[9]-ix-rx-cx-mx-a1-nx-tx-ex-h3) [TaxId: 39012]}
ldgpyqptslnlpvdywmliaptregkvaegtnttdrwfacvlvepnvqntqrqyvldgq
nvqlhvsndsstswkfilfikltpdgtytqystlstphklcawmkrdnrvywyqgatpna
sesyyltinndnsnvssdaefylipqsqtamctqyinngl

Timeline for d5cb7b_:

• d5cb7b_ first appeared in SCOPe 2.06
  
• d5cb7b_ appears in SCOPe 2.07