Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (70 species) not a true protein |
Species Rotavirus a (strain human/japan/k8/1977 g1-p3a[9]-ix-rx-cx-mx-a1-nx-tx-ex-h3) [TaxId:39012] [318080] (2 PDB entries) |
Domain d5cb7a_: 5cb7 A: [318081] automated match to d2p3ka_ complexed with a2g, cl, fuc, gal, gol |
PDB Entry: 5cb7 (more details), 1.35 Å
SCOPe Domain Sequences for d5cb7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cb7a_ b.29.1.0 (A:) automated matches {Rotavirus a (strain human/japan/k8/1977 g1-p3a[9]-ix-rx-cx-mx-a1-nx-tx-ex-h3) [TaxId: 39012]} ldgpyqptslnlpvdywmliaptregkvaegtnttdrwfacvlvepnvqntqrqyvldgq nvqlhvsndsstswkfilfikltpdgtytqystlstphklcawmkrdnrvywyqgatpna sesyyltinndnsnvssdaefylipqsqtamctqyinngl
Timeline for d5cb7a_: