Lineage for d5buyb_ (5buy B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944398Species Francisella tularensis [TaxId:177416] [318070] (1 PDB entry)
  8. 2944400Domain d5buyb_: 5buy B: [318071]
    automated match to d3d6xb_
    complexed with so4

Details for d5buyb_

PDB Entry: 5buy (more details), 2.55 Å

PDB Description: crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from francisella tularensis
PDB Compounds: (B:) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ

SCOPe Domain Sequences for d5buyb_:

Sequence, based on SEQRES records: (download)

>d5buyb_ d.38.1.0 (B:) automated matches {Francisella tularensis [TaxId: 177416]}
nkqidvmgirkilphrypfalldkivdwsvedrtivaqknvtinedffnghfpdfpvmpg
vliveamaqatailgelmaetlfahvvekagggrrtfmlagidkvrvkrpvvpgdvlvie
srmvkqkniictaesvakvdgqivcsaelmaaykd

Sequence, based on observed residues (ATOM records): (download)

>d5buyb_ d.38.1.0 (B:) automated matches {Francisella tularensis [TaxId: 177416]}
nkqidvmgirkilphrypfalldkivdwsvedrtivaqknvtinedffnghfpdfpvmpg
vliveamaqatailgelmaetlftfmlagidkvrvkrpvvpgdvlviesrmvkqkniict
aesvakvdgqivcsaelmaaykd

SCOPe Domain Coordinates for d5buyb_:

Click to download the PDB-style file with coordinates for d5buyb_.
(The format of our PDB-style files is described here.)

Timeline for d5buyb_: