Lineage for d1tkba1 (1tkb A:3-337)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472772Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2472773Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2473216Family c.36.1.10: TK-like PP module [88760] (3 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 2473235Protein Transketolase (TK), PP module [88761] (4 species)
  7. 2473236Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88762] (7 PDB entries)
  8. 2473241Domain d1tkba1: 1tkb A:3-337 [31807]
    Other proteins in same PDB: d1tkba2, d1tkba3, d1tkbb2, d1tkbb3
    complexed with ca, n1t

Details for d1tkba1

PDB Entry: 1tkb (more details), 2.3 Å

PDB Description: specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d1tkba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkba1 c.36.1.10 (A:3-337) Transketolase (TK), PP module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
kpgveannkwnklfseyqkkfpelgaelarrlsgq

SCOPe Domain Coordinates for d1tkba1:

Click to download the PDB-style file with coordinates for d1tkba1.
(The format of our PDB-style files is described here.)

Timeline for d1tkba1: