Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.10: TK-like PP module [88760] (3 proteins) different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain |
Protein Transketolase (TK), PP module [88761] (4 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88762] (7 PDB entries) |
Domain d1tkba1: 1tkb A:3-337 [31807] Other proteins in same PDB: d1tkba2, d1tkba3, d1tkbb2, d1tkbb3 complexed with ca, n1t |
PDB Entry: 1tkb (more details), 2.3 Å
SCOPe Domain Sequences for d1tkba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tkba1 c.36.1.10 (A:3-337) Transketolase (TK), PP module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil kpgveannkwnklfseyqkkfpelgaelarrlsgq
Timeline for d1tkba1: