Lineage for d5azpb1 (5azp B:1-447)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022539Fold f.5: Outer membrane efflux proteins (OEP) [56953] (1 superfamily)
    subunit fold contains tandem repeat of alpha-beta hairpin-alpha(2) motif
    trimeric fold contains barrel (n=12, S=18) formed by beta-hairpins, two from each subunit, and a bundle of helices with a channel running through it
  4. 3022540Superfamily f.5.1: Outer membrane efflux proteins (OEP) [56954] (2 families) (S)
  5. 3022576Family f.5.1.0: automated matches [227266] (1 protein)
    not a true family
  6. 3022577Protein automated matches [227059] (5 species)
    not a true protein
  7. 3022587Species Pseudomonas aeruginosa [TaxId:208964] [318062] (5 PDB entries)
  8. 3022589Domain d5azpb1: 5azp B:1-447 [318065]
    Other proteins in same PDB: d5azpb2
    automated match to d1wp1b_
    complexed with 3pk, act, bog, fmt, gol, na, oya

Details for d5azpb1

PDB Entry: 5azp (more details), 1.69 Å

PDB Description: crystal structure of a membrane protein from pseudomonas aeruginosa
PDB Compounds: (B:) Multidrug efflux outer membrane protein OprN

SCOPe Domain Sequences for d5azpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5azpb1 f.5.1.0 (B:1-447) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
ctvgpdyrtpdtaaakidataskpydrsrfeslwwkqfddptlnqlveqslsgnrdlrva
farlraaralrddvandrfpvvtsrasadigkgqqpgvtedrvnserydlgldsaweldl
fgrirrqlessdalseaaeadlqqlqvsliaelvdaygqlrgaqlrekialsnlenqkes
rqlteqlrdagvgaeldvlradarlaataasvpqlqaeaerarhriatllgqrpeeltvd
lsprdlpaitkalpigdpgellrrrpdiraaerrlaastadvgvatadlfprvslsgflg
ftagrgsqigssaarawsvgpsiswaafdlgsvrarlrgakadadaalasyeqqvllale
esanafsdygkrqerlvslvrqseasraaaqqaairyregttdflvlldaereqlsaeda
qaqaevelyrgivaiyrslgggwqpsa

SCOPe Domain Coordinates for d5azpb1:

Click to download the PDB-style file with coordinates for d5azpb1.
(The format of our PDB-style files is described here.)

Timeline for d5azpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5azpb2