Lineage for d5ayrc1 (5ayr C:85-304)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2437896Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2437897Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2437898Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 protein domains)
  6. 2437899Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 2437942Species Human (Homo sapiens) [TaxId:9606] [52144] (15 PDB entries)
  8. 2437957Domain d5ayrc1: 5ayr C:85-304 [318064]
    Other proteins in same PDB: d5ayra2, d5ayra3, d5ayrc2, d5ayrc3
    automated match to d1emha_
    protein/DNA complex; complexed with mg

Details for d5ayrc1

PDB Entry: 5ayr (more details), 2.4 Å

PDB Description: the crystal structure of saugi/human udg complex
PDB Compounds: (C:) uracil-DNA glycosylase

SCOPe Domain Sequences for d5ayrc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ayrc1 c.18.1.1 (C:85-304) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
fgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvilgq
dpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvllln
avltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrhhvl
qtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

SCOPe Domain Coordinates for d5ayrc1:

Click to download the PDB-style file with coordinates for d5ayrc1.
(The format of our PDB-style files is described here.)

Timeline for d5ayrc1: