Lineage for d5azsb_ (5azs B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022539Fold f.5: Outer membrane efflux proteins (OEP) [56953] (1 superfamily)
    subunit fold contains tandem repeat of alpha-beta hairpin-alpha(2) motif
    trimeric fold contains barrel (n=12, S=18) formed by beta-hairpins, two from each subunit, and a bundle of helices with a channel running through it
  4. 3022540Superfamily f.5.1: Outer membrane efflux proteins (OEP) [56954] (2 families) (S)
  5. 3022576Family f.5.1.0: automated matches [227266] (1 protein)
    not a true family
  6. 3022577Protein automated matches [227059] (5 species)
    not a true protein
  7. 3022587Species Pseudomonas aeruginosa [TaxId:208964] [318062] (5 PDB entries)
  8. 3022599Domain d5azsb_: 5azs B: [318063]
    automated match to d1wp1a_

Details for d5azsb_

PDB Entry: 5azs (more details), 3.1 Å

PDB Description: crystal structure of a membrane protein from pseudomonas aeruginosa
PDB Compounds: (B:) Outer membrane protein OprJ

SCOPe Domain Sequences for d5azsb_:

Sequence, based on SEQRES records: (download)

>d5azsb_ f.5.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
csmaptyerpaapvadswsgaaaqrqgaaidtldwksfivdaelrrlvdmaldnnrslrq
tlldieaaraqyriqradrvpglnaaatgnrqrqpadlsagnrsevassyqvglalpeye
ldlfgrvksltdaalqqylaseeaaraarialvaevsqaylsydgalrrlaltrqtlvsr
eysfalidqrraagaataldyqealglveqaraeqernlrqkqqafnalvlllgsddaaq
aiprspgqrpkllqdiapgtpselierrpdilaaehrlrarnadigaaraaffprisltg
sfgtssaemsglfdggsrswsflptltlpifdggrnranlslaearkdsavaayegtiqt
afrevadalaasdtlrreekalralanssnealklakaryesgvdnhlryldaqrssfln
eiafidgstqrqialvdlfralg

Sequence, based on observed residues (ATOM records): (download)

>d5azsb_ f.5.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
csmaptyerpaapvadswsgaidtldwksfivdaelrrlvdmaldnnrslrqtlldieaa
raqyriqradrvpglnaaatgnrqrqpadlsagnrsevassyqvglalpeyeldlfgrvk
sltdaalqqylaseeaaraarialvaevsqaylsydgalrrlaltrqtlvsreysfalid
qrraagaataldyqealglveqaraeqernlrqkqqafnalvlllgsddaaqaiprspgq
rpkllqdiapgtpselierrpdilaaehrlrarnadigaaraaffprisltgsfgtssae
msglfdggsrswsflptltlpifdggrnranlslaearkdsavaayegtiqtafrevada
laasdtlrreekalralanssnealklakaryesgvdnhlryldaqrssflneiafidgs
tqrqialvdlfralg

SCOPe Domain Coordinates for d5azsb_:

Click to download the PDB-style file with coordinates for d5azsb_.
(The format of our PDB-style files is described here.)

Timeline for d5azsb_: