Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein automated matches [190384] (21 species) not a true protein |
Species Porcine epidemic diarrhea virus [TaxId:28295] [311580] (3 PDB entries) |
Domain d5hyoa_: 5hyo A: [318051] automated match to d3tloa_ complexed with dms, ipa, mpd |
PDB Entry: 5hyo (more details), 2.1 Å
SCOPe Domain Sequences for d5hyoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hyoa_ b.47.1.4 (A:) automated matches {Porcine epidemic diarrhea virus [TaxId: 28295]} aglrkmaqpsgvvekcivrvcygnmalnglwlgdtvicprhviassttstidydyalsvl rlhnfsissgnvflgvvgvtmrgallqikvnqnnvhtpkytyrtvrpgesfnilacydgs aagvygvnmrsnytirgsfingacgspgyninngtvefcylhqlelgsgchvgsdldgvm yggyedqptlqvegasslftenvlaflyaalingstwwlsssriavdrfnewavhngmtt vvntdcfsilaaktgvdvqrllasiqslhknfggkqilgytsltdefttgevirqmygvn l
Timeline for d5hyoa_: