Lineage for d1trkb1 (1trk B:3-337)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122269Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2122270Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2122701Family c.36.1.10: TK-like PP module [88760] (3 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 2122720Protein Transketolase (TK), PP module [88761] (4 species)
  7. 2122721Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88762] (7 PDB entries)
  8. 2122725Domain d1trkb1: 1trk B:3-337 [31805]
    Other proteins in same PDB: d1trka2, d1trka3, d1trkb2, d1trkb3
    complexed with ca, tpp

Details for d1trkb1

PDB Entry: 1trk (more details), 2 Å

PDB Description: refined structure of transketolase from saccharomyces cerevisiae at 2.0 angstroms resolution
PDB Compounds: (B:) transketolase

SCOPe Domain Sequences for d1trkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1trkb1 c.36.1.10 (B:3-337) Transketolase (TK), PP module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
kpgveannkwnklfseyqkkfpelgaelarrlsgq

SCOPe Domain Coordinates for d1trkb1:

Click to download the PDB-style file with coordinates for d1trkb1.
(The format of our PDB-style files is described here.)

Timeline for d1trkb1: