Lineage for d5jwza1 (5jwz A:8-416)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399102Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2399797Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families) (S)
    duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378)
  5. 2399811Family b.69.13.0: automated matches [227242] (1 protein)
    not a true family
  6. 2399812Protein automated matches [227008] (5 species)
    not a true protein
  7. 2399845Species Streptomyces sp. [TaxId:862751] [318010] (1 PDB entry)
  8. 2399846Domain d5jwza1: 5jwz A:8-416 [318049]
    automated match to d5fkta1
    complexed with ca, edo

Details for d5jwza1

PDB Entry: 5jwz (more details), 1.7 Å

PDB Description: structure of a putative xyloglucanase from the cellulolytic bacteria streptomyces sp. sirexaa-e
PDB Compounds: (A:) Cellulose-binding family II

SCOPe Domain Sequences for d5jwza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jwza1 b.69.13.0 (A:8-416) automated matches {Streptomyces sp. [TaxId: 862751]}
dtytwknaridgggfvpgivfnrseknlayartdiggayrwdqsgkqwkplldwvdwdrw
gwtgvvslasdtvdpdnvyaavgtytnswdptdgavlrssdrgaswkaatlpfklggnmp
grgmgerlavdpnknsvlylgapsgnglwrstdagvswsevtafpnpgnyaqdpsdtsgy
gndnqgivwvtfdersgsagsatqdiyvgvadkentvyrstdggatwsripgqptgylah
kgvldsatghlyltlsdtggpydggkgriwrydtasgawqdvspvaeadayygfsglsvd
rqkpgtlmataysswwpdtqifrstdsgatwtqawdytgypnrsnrytldvssvpwlswg
aspappetapklgwmtealeidpfdsdrmmygtgatvygtedltswdsg

SCOPe Domain Coordinates for d5jwza1:

Click to download the PDB-style file with coordinates for d5jwza1.
(The format of our PDB-style files is described here.)

Timeline for d5jwza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jwza2