Lineage for d5hysd1 (5hys D:1-110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756208Domain d5hysd1: 5hys D:1-110 [318044]
    Other proteins in same PDB: d5hysa_, d5hysb2, d5hysc_, d5hysd2, d5hyse_, d5hysf2, d5hysg1, d5hysg2, d5hysh_, d5hysi1, d5hysi2, d5hysj1, d5hysj2, d5hysk1, d5hysk2, d5hysl2
    automated match to d1dn0a1
    complexed with so4

Details for d5hysd1

PDB Entry: 5hys (more details), 2.5 Å

PDB Description: structure of ige complexed with omalizumab
PDB Compounds: (D:) Uncharacterized protein

SCOPe Domain Sequences for d5hysd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hysd1 b.1.1.0 (D:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqltqspsslsasvgdrvtitcrasqsvdydgdsymnwyqqkpgkapklliyaasyles
gvpsrfsgsgsgtdftltisslqpedfatyycqqshedpytfgqgtkvei

SCOPe Domain Coordinates for d5hysd1:

Click to download the PDB-style file with coordinates for d5hysd1.
(The format of our PDB-style files is described here.)

Timeline for d5hysd1: