![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
![]() | Domain d5hysd1: 5hys D:1-110 [318044] Other proteins in same PDB: d5hysa_, d5hysb2, d5hysc_, d5hysd2, d5hyse_, d5hysf2, d5hysg1, d5hysg2, d5hysh_, d5hysi1, d5hysi2, d5hysj1, d5hysj2, d5hysk1, d5hysk2, d5hysl2 automated match to d1dn0a1 complexed with so4 |
PDB Entry: 5hys (more details), 2.5 Å
SCOPe Domain Sequences for d5hysd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hysd1 b.1.1.0 (D:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqltqspsslsasvgdrvtitcrasqsvdydgdsymnwyqqkpgkapklliyaasyles gvpsrfsgsgsgtdftltisslqpedfatyycqqshedpytfgqgtkvei
Timeline for d5hysd1: