| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d5hysf1: 5hys F:1-110 [318042] Other proteins in same PDB: d5hysa_, d5hysb2, d5hysc_, d5hysd2, d5hyse_, d5hysf2, d5hysg1, d5hysg2, d5hysh_, d5hysi1, d5hysi2, d5hysj1, d5hysj2, d5hysk1, d5hysk2, d5hysl2 automated match to d1dn0a1 complexed with so4 |
PDB Entry: 5hys (more details), 2.5 Å
SCOPe Domain Sequences for d5hysf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hysf1 b.1.1.0 (F:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqltqspsslsasvgdrvtitcrasqsvdydgdsymnwyqqkpgkapklliyaasyles
gvpsrfsgsgsgtdftltisslqpedfatyycqqshedpytfgqgtkvei
Timeline for d5hysf1: