Lineage for d4zt1a2 (4zt1 A:102-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763414Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. 2763415Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. 2763423Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 2763424Species Human (Homo sapiens) [TaxId:9606] [81981] (12 PDB entries)
  8. 2763435Domain d4zt1a2: 4zt1 A:102-213 [318041]
    automated match to d3qrba2
    complexed with ca

Details for d4zt1a2

PDB Entry: 4zt1 (more details), 1.92 Å

PDB Description: crystal structure of human e-cadherin (residues 3-213) in x-dimer conformation
PDB Compounds: (A:) Cadherin-1

SCOPe Domain Sequences for d4zt1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zt1a2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
ndnkpeftqevfkgsvmegalpgtsvmevtatdadddvntynaaiaytilsqdpelpdkn
mftinrntgvisvvttgldresfptytlvvqaadlqgeglsttatavitvtd

SCOPe Domain Coordinates for d4zt1a2:

Click to download the PDB-style file with coordinates for d4zt1a2.
(The format of our PDB-style files is described here.)

Timeline for d4zt1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zt1a1