Lineage for d1trka2 (1trk A:338-534)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2864714Family c.36.1.6: TK-like Pyr module [88735] (2 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 2864729Protein Transketolase (TK), Pyr module [88736] (4 species)
  7. 2864730Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88737] (7 PDB entries)
  8. 2864731Domain d1trka2: 1trk A:338-534 [31804]
    Other proteins in same PDB: d1trka1, d1trka3, d1trkb1, d1trkb3
    complexed with ca, tpp

Details for d1trka2

PDB Entry: 1trk (more details), 2 Å

PDB Description: refined structure of transketolase from saccharomyces cerevisiae at 2.0 angstroms resolution
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d1trka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1trka2 c.36.1.6 (A:338-534) Transketolase (TK), Pyr module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lpanwesklptytakdsavatrklsetvledvynqlpeliggsadltpsnltrwkealdf
qppssgsgnysgryirygirehamgaimngisafganykpyggtflnfvsyaagavrlsa
lsghpviwvathdsigvgedgpthqpietlahfrslpniqvwrpadgnevsaayknsles
khtpsiialsrqnlpql

SCOPe Domain Coordinates for d1trka2:

Click to download the PDB-style file with coordinates for d1trka2.
(The format of our PDB-style files is described here.)

Timeline for d1trka2: