SCOPe 2.07: Domain d4zteb1: 4zte B:4-101

Lineage for d4zteb1 (4zte B:4-101)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.1: Cadherin [49314] (4 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Human (Homo sapiens) [TaxId:9606] [81981] (12 PDB entries)

8. Domain d4zteb1: 4zte B:4-101 [318037]
   automated match to d1edha1
   complexed with 4rl, ca

Details for d4zteb1

PDB Entry: 4zte, 2.13 Å

PDB Description: crystal structure of human e-cadherin (residues 3-213) in complex with a peptidomimetic inhibitor

PDB Compounds: (B:) Cadherin-1

SCOPe Domain Sequences for d4zteb1:

Sequence; same for both SEQRES and ATOM records:

>d4zteb1 b.1.6.1 (B:4-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
ippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgwlkvt
epldreriatytlfshavssngnavedpmeilitvtdq

Timeline for d4zteb1:

• d4zteb1 first appeared in SCOPe 2.06
  
• d4zteb1 appears in the current release, SCOPe 2.08