Lineage for d4zteb1 (4zte B:4-101)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763414Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. 2763415Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. 2763423Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 2763424Species Human (Homo sapiens) [TaxId:9606] [81981] (12 PDB entries)
  8. 2763444Domain d4zteb1: 4zte B:4-101 [318037]
    automated match to d1edha1
    complexed with 4rl, ca

Details for d4zteb1

PDB Entry: 4zte (more details), 2.13 Å

PDB Description: crystal structure of human e-cadherin (residues 3-213) in complex with a peptidomimetic inhibitor
PDB Compounds: (B:) Cadherin-1

SCOPe Domain Sequences for d4zteb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zteb1 b.1.6.1 (B:4-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
ippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgwlkvt
epldreriatytlfshavssngnavedpmeilitvtdq

SCOPe Domain Coordinates for d4zteb1:

Click to download the PDB-style file with coordinates for d4zteb1.
(The format of our PDB-style files is described here.)

Timeline for d4zteb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zteb2