| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
| Family b.1.6.1: Cadherin [49314] (4 proteins) |
| Protein E-cadherin (epithelial) [49317] (2 species) synonym: uvomorulin |
| Species Human (Homo sapiens) [TaxId:9606] [81981] (12 PDB entries) |
| Domain d4zt1b2: 4zt1 B:102-213 [318036] automated match to d3qrba2 complexed with ca |
PDB Entry: 4zt1 (more details), 1.92 Å
SCOPe Domain Sequences for d4zt1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zt1b2 b.1.6.1 (B:102-213) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
ndnkpeftqevfkgsvmegalpgtsvmevtatdadddvntynaaiaytilsqdpelpdkn
mftinrntgvisvvttgldresfptytlvvqaadlqgeglsttatavitvtd
Timeline for d4zt1b2: