SCOPe 2.08: Domain d4zt1b2: 4zt1 B:102-213

Lineage for d4zt1b2 (4zt1 B:102-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (4 families)

5. Family b.1.6.1: Cadherin [49314] (4 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Human (Homo sapiens) [TaxId:9606] [81981] (12 PDB entries)

8. Domain d4zt1b2: 4zt1 B:102-213 [318036]
   automated match to d3qrba2
   complexed with ca

Details for d4zt1b2

PDB Entry: 4zt1, 1.92 Å

PDB Description: crystal structure of human e-cadherin (residues 3-213) in x-dimer conformation

PDB Compounds: (B:) Cadherin-1

SCOPe Domain Sequences for d4zt1b2:

Sequence; same for both SEQRES and ATOM records:

>d4zt1b2 b.1.6.1 (B:102-213) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
ndnkpeftqevfkgsvmegalpgtsvmevtatdadddvntynaaiaytilsqdpelpdkn
mftinrntgvisvvttgldresfptytlvvqaadlqgeglsttatavitvtd

Timeline for d4zt1b2:

• d4zt1b2 first appeared in SCOPe 2.06
  
• d4zt1b2 appears in SCOPe 2.07