Lineage for d5hysb2 (5hys B:111-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750729Domain d5hysb2: 5hys B:111-217 [318030]
    Other proteins in same PDB: d5hysa_, d5hysb1, d5hysc_, d5hysd1, d5hyse_, d5hysf1, d5hysh_, d5hysl1
    automated match to d1dn0a2
    complexed with so4

Details for d5hysb2

PDB Entry: 5hys (more details), 2.5 Å

PDB Description: structure of ige complexed with omalizumab
PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d5hysb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hysb2 b.1.1.2 (B:111-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5hysb2:

Click to download the PDB-style file with coordinates for d5hysb2.
(The format of our PDB-style files is described here.)

Timeline for d5hysb2: