![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.10: TK-like PP module [88760] (3 proteins) different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain |
![]() | Protein Transketolase (TK), PP module [88761] (4 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88762] (7 PDB entries) |
![]() | Domain d1trka1: 1trk A:3-337 [31803] Other proteins in same PDB: d1trka2, d1trka3, d1trkb2, d1trkb3 complexed with ca, tpp |
PDB Entry: 1trk (more details), 2 Å
SCOPe Domain Sequences for d1trka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1trka1 c.36.1.10 (A:3-337) Transketolase (TK), PP module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil kpgveannkwnklfseyqkkfpelgaelarrlsgq
Timeline for d1trka1: