SCOPe 2.06: Domain d5hmlb1: 5hml B:20-185

Lineage for d5hmlb1 (5hml B:20-185)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (3 families)

5. Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
   contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold

6. Protein T5 5'-exonuclease [53050] (1 species)

7. Species Bacteriophage T5 [TaxId:10726] [53051] (6 PDB entries)

8. Domain d5hmlb1: 5hml B:20-185 [318027]
   Other proteins in same PDB: d5hmla2, d5hmlb2
   automated match to d1exna2
   complexed with b3p, cl, edo, iod, mg

Details for d5hmlb1

PDB Entry: 5hml, 1.48 Å

PDB Description: crystal structure of t5 d15 protein co-crystallized with metal ions

PDB Compounds: (B:) exodeoxyribonuclease

SCOPe Domain Sequences for d5hmlb1:

Sequence; same for both SEQRES and ATOM records:

>d5hmlb1 c.120.1.2 (B:20-185) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]}
rnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrlehl
peykgnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivkl
ighlydhvwlistkgdwdtlltdkvsrfsfttrreyhlrdmyehhn

Timeline for d5hmlb1:

• d5hmlb1 is new in SCOPe 2.06-stable
  
• d5hmlb1 appears in SCOPe 2.07
  
• d5hmlb1 appears in the current release, SCOPe 2.08