| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
| Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins) strand 5 is parallel to strand 4 Pfam PF08210; Pfam PF05240 |
| Protein automated matches [310855] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [311219] (20 PDB entries) |
| Domain d2nbqa1: 2nbq A:187-382 [318025] Other proteins in same PDB: d2nbqa2 automated match to d2kema_ complexed with zn |
PDB Entry: 2nbq (more details)
SCOPe Domain Sequences for d2nbqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nbqa1 c.97.1.6 (A:187-382) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eilrylmdpdtftfnfnndplvlrrrqtylcyeverldngtwvlmdqhmgflcneaknll
cgfygrhaelrfldlvpslqldpaqiyrvtwfiswspcfswgcagevraflqenthvrlr
ifaariydydplykealqmlrdagaqvsimtydefeycwdtfvyrqgcpfqpwdgleehs
qalsgrlrailqnqgn
Timeline for d2nbqa1: