Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
Protein Benzoylformate decarboxylase [88756] (1 species) |
Species Pseudomonas putida [TaxId:303] [88757] (7 PDB entries) Uniprot P20906 |
Domain d1bfda3: 1bfd A:342-524 [31802] Other proteins in same PDB: d1bfda1, d1bfda2 complexed with ca, mg, tpp |
PDB Entry: 1bfd (more details), 1.6 Å
SCOPe Domain Sequences for d1bfda3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bfda3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygal rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev stv
Timeline for d1bfda3: