Lineage for d1bfd_3 (1bfd 342-524)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483377Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 483378Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 483525Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (7 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 483532Protein Benzoylformate decarboxylase [88756] (1 species)
  7. 483533Species Pseudomonas putida [TaxId:303] [88757] (2 PDB entries)
  8. 483534Domain d1bfd_3: 1bfd 342-524 [31802]
    Other proteins in same PDB: d1bfd_1, d1bfd_2

Details for d1bfd_3

PDB Entry: 1bfd (more details), 1.6 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida

SCOP Domain Sequences for d1bfd_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfd_3 c.36.1.9 (342-524) Benzoylformate decarboxylase {Pseudomonas putida}
epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag
glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygal
rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev
stv

SCOP Domain Coordinates for d1bfd_3:

Click to download the PDB-style file with coordinates for d1bfd_3.
(The format of our PDB-style files is described here.)

Timeline for d1bfd_3: