SCOPe 2.08: Domain d5jb8s_: 5jb8 S:

Lineage for d5jb8s_ (5jb8 S:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Coagulation factor IXa, protease domain [50583] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50585] (21 PDB entries)

8. Domain d5jb8s_: 5jb8 S: [318019]
   Other proteins in same PDB: d5jb8e_
   automated match to d3lc3a_
   complexed with 0gj, ca, dms

Details for d5jb8s_

PDB Entry: 5jb8, 1.45 Å

PDB Description: crystal structure of factor ixa variant k98t in complex with egr- chloromethylketone

PDB Compounds: (S:) coagulation factor ix

SCOPe Domain Sequences for d5jb8s_:

Sequence; same for both SEQRES and ATOM records:

>d5jb8s_ b.47.1.2 (S:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnynaaintynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftiynnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt

Timeline for d5jb8s_:

• d5jb8s_ first appeared in SCOPe 2.06
  
• d5jb8s_ appears in SCOPe 2.07