Lineage for d1bfd_2 (1bfd 2-181)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312976Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 312977Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 312978Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (5 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 312985Protein Benzoylformate decarboxylase [88731] (1 species)
  7. 312986Species Pseudomonas putida [TaxId:303] [88732] (2 PDB entries)
  8. 312987Domain d1bfd_2: 1bfd 2-181 [31801]
    Other proteins in same PDB: d1bfd_1, d1bfd_3
    complexed with ca, mg, tpp

Details for d1bfd_2

PDB Entry: 1bfd (more details), 1.6 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida

SCOP Domain Sequences for d1bfd_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfd_2 c.36.1.5 (2-181) Benzoylformate decarboxylase {Pseudomonas putida}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss

SCOP Domain Coordinates for d1bfd_2:

Click to download the PDB-style file with coordinates for d1bfd_2.
(The format of our PDB-style files is described here.)

Timeline for d1bfd_2: