Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins) automatically mapped to Pfam PF00891 |
Protein Carminomycin 4-O-methyltransferase [110660] (1 species) |
Species Streptomyces peucetius [TaxId:1950] [110661] (6 PDB entries) Uniprot Q06528 |
Domain d5jr3c2: 5jr3 C:100-353 [318007] Other proteins in same PDB: d5jr3a1, d5jr3b1, d5jr3c1 automated match to d1tw2b2 complexed with 4mu, sah, so4 |
PDB Entry: 5jr3 (more details), 1.84 Å
SCOPe Domain Sequences for d5jr3c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jr3c2 c.66.1.12 (C:100-353) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} paaqrawhdltqavaradisftrlpdairtgrptyesiygkpfyedlagrpdlrasfdsl lacdqdvafdapaaaydwtnvrhvldvgggkggfaaaiarraphvsatvlemagtvdtar sylkdeglsdrvdvvegdffeplprkadaiilsfvllnwpdhdavriltrcaealepggr iliherddlhensfneqfteldlrmlvflggalrtrekwdglaasaglvveevrqlpspt ipydlsllvlapaa
Timeline for d5jr3c2:
View in 3D Domains from other chains: (mouse over for more information) d5jr3a1, d5jr3a2, d5jr3b1, d5jr3b2 |