SCOPe 2.06: Domain d5hzqa1: 5hzq A:0-137

Lineage for d5hzqa1 (5hzq A:0-137)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187133] (57 PDB entries)

8. Domain d5hzqa1: 5hzq A:0-137 [318004]
   Other proteins in same PDB: d5hzqa2
   automated match to d1vyfa_
   complexed with gol, ywz

Details for d5hzqa1

PDB Entry: 5hzq, 1.75 Å

PDB Description: crystal structure of cellular retinoic acid binding protein 2 (crabp2)-aryl fluorosulfate covalent conjugate

PDB Compounds: (A:) Cellular retinoic acid-binding protein 2

SCOPe Domain Sequences for d5hzqa1:

Sequence; same for both SEQRES and ATOM records:

>d5hzqa1 b.60.1.2 (A:0-137) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvr
tteinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgel
iltmtaddvvctrvyvre

Timeline for d5hzqa1:

• d5hzqa1 is new in SCOPe 2.06-stable
  
• d5hzqa1 appears in SCOPe 2.07
  
• d5hzqa1 appears in the current release, SCOPe 2.08