![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
![]() | Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species) |
![]() | Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (76 PDB entries) |
![]() | Domain d5hzqa1: 5hzq A:0-137 [318004] Other proteins in same PDB: d5hzqa2 automated match to d1vyfa_ complexed with gol, ywz |
PDB Entry: 5hzq (more details), 1.75 Å
SCOPe Domain Sequences for d5hzqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hzqa1 b.60.1.2 (A:0-137) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]} mpnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvr tteinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgel iltmtaddvvctrvyvre
Timeline for d5hzqa1: