SCOPe 2.07: Domain d5jbbs_: 5jbb S:

Lineage for d5jbbs_ (5jbb S:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Coagulation factor IXa, protease domain [50583] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50585] (20 PDB entries)

8. Domain d5jbbs_: 5jbb S: [318002]
   Other proteins in same PDB: d5jbbe_
   automated match to d2wpis_
   complexed with 0gj, ca, dms

Details for d5jbbs_

PDB Entry: 5jbb, 1.56 Å

PDB Description: crystal structure of factor ixa variant v16i k98t y177t i213v in complex with egr-chloromethylketone

PDB Compounds: (S:) coagulation factor ix

SCOPe Domain Sequences for d5jbbs_:

Sequence; same for both SEQRES and ATOM records:

>d5jbbs_ b.47.1.2 (S:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
ivggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnynaaintynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftitnnmfcagfheggrds
cqgdsggphvtevegtsfltgivswgeecamkgkygiytkvsryvnwikektklt

Timeline for d5jbbs_:

• d5jbbs_ first appeared in SCOPe 2.06
  
• d5jbbs_ appears in the current release, SCOPe 2.08