Lineage for d5hmma2 (5hmm A:186-290)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716189Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) (S)
  5. 2716190Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 2716223Protein T5 5'-exonuclease [47813] (1 species)
  7. 2716224Species Bacteriophage T5 [TaxId:10726] [47814] (6 PDB entries)
  8. 2716227Domain d5hmma2: 5hmm A:186-290 [318001]
    Other proteins in same PDB: d5hmma1, d5hmmb1
    automated match to d1xo1a1
    complexed with cl, edo, mg

Details for d5hmma2

PDB Entry: 5hmm (more details), 1.5 Å

PDB Description: crystal structure of t5 d15 protein co-crystallized with metal ions
PDB Compounds: (A:) exodeoxyribonuclease

SCOPe Domain Sequences for d5hmma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hmma2 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]}
vddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqn
lnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiae

SCOPe Domain Coordinates for d5hmma2:

Click to download the PDB-style file with coordinates for d5hmma2.
(The format of our PDB-style files is described here.)

Timeline for d5hmma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hmma1