| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) ![]() |
| Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins) |
| Protein T5 5'-exonuclease [47813] (1 species) |
| Species Bacteriophage T5 [TaxId:10726] [47814] (6 PDB entries) |
| Domain d5hmma2: 5hmm A:186-290 [318001] Other proteins in same PDB: d5hmma1, d5hmmb1 automated match to d1xo1a1 complexed with cl, edo, mg |
PDB Entry: 5hmm (more details), 1.5 Å
SCOPe Domain Sequences for d5hmma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hmma2 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]}
vddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqn
lnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiae
Timeline for d5hmma2: