SCOPe 2.08: Domain d5hmma2: 5hmm A:186-290

Lineage for d5hmma2 (5hmm A:186-290)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families)

5. Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)

6. Protein T5 5'-exonuclease [47813] (1 species)

7. Species Bacteriophage T5 [TaxId:10726] [47814] (6 PDB entries)

8. Domain d5hmma2: 5hmm A:186-290 [318001]
   Other proteins in same PDB: d5hmma1, d5hmmb1
   automated match to d1xo1a1
   complexed with cl, edo, mg

Details for d5hmma2

PDB Entry: 5hmm, 1.5 Å

PDB Description: crystal structure of t5 d15 protein co-crystallized with metal ions

PDB Compounds: (A:) exodeoxyribonuclease

SCOPe Domain Sequences for d5hmma2:

Sequence; same for both SEQRES and ATOM records:

>d5hmma2 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]}
vddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqn
lnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiae

Timeline for d5hmma2:

• d5hmma2 first appeared in SCOPe 2.06
  
• d5hmma2 appears in SCOPe 2.07