| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries) |
| Domain d5hggs_: 5hgg S: [317995] Other proteins in same PDB: d5hgga_, d5hggb_, d5hggt2 automated match to d2vyrh_ complexed with gol, mes, so4, twn |
PDB Entry: 5hgg (more details), 1.97 Å
SCOPe Domain Sequences for d5hggs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hggs_ b.1.1.1 (S:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlqesggglvqaggslrlscaasgftldsyaigwfrqapgkeregvscisasggstny
adsvkgrftisrdnakntvylqmnslksedtavyycaadhpglctsesgrrrylevwgqg
tqvtvssa
Timeline for d5hggs_:
View in 3DDomains from other chains: (mouse over for more information) d5hgga_, d5hggb_, d5hggt1, d5hggt2 |