Lineage for d5hggs_ (5hgg S:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745477Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)
  8. 2745532Domain d5hggs_: 5hgg S: [317995]
    Other proteins in same PDB: d5hgga_, d5hggb_, d5hggt2
    automated match to d2vyrh_
    complexed with gol, mes, so4, twn

Details for d5hggs_

PDB Entry: 5hgg (more details), 1.97 Å

PDB Description: crystal structure of upa in complex with a camelid-derived antibody fragment
PDB Compounds: (S:) Camelid Derived Antibody Fragment, Nb4

SCOPe Domain Sequences for d5hggs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hggs_ b.1.1.1 (S:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlqesggglvqaggslrlscaasgftldsyaigwfrqapgkeregvscisasggstny
adsvkgrftisrdnakntvylqmnslksedtavyycaadhpglctsesgrrrylevwgqg
tqvtvssa

SCOPe Domain Coordinates for d5hggs_:

Click to download the PDB-style file with coordinates for d5hggs_.
(The format of our PDB-style files is described here.)

Timeline for d5hggs_: