SCOP 1.61: Domain d1powb2: 1pow B:9-182

Lineage for d1powb2 (1pow B:9-182)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families)

5. Family c.36.1.1: Pyruvate oxidase and decarboxylase [52519] (4 proteins)

6. Protein Pyruvate oxidase [52524] (1 species)

7. Species Lactobacillus plantarum [TaxId:1590] [52525] (2 PDB entries)

8. Domain d1powb2: 1pow B:9-182 [31799]
   Other proteins in same PDB: d1powa1, d1powb1

Details for d1powb2

PDB Entry: 1pow, 2.5 Å

PDB Description: the refined structures of a stabilized mutant and of wild-type pyruvate oxidase from lactobacillus plantarum

SCOP Domain Sequences for d1powb2:

Sequence; same for both SEQRES and ATOM records:

>d1powb2 c.36.1.1 (B:9-182) Pyruvate oxidase {Lactobacillus plantarum}
tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedw

Timeline for d1powb2:

• d1powb2 first appeared (with stable ids) in SCOP 1.55
  
• d1powb2 appears in SCOP 1.59
  
• d1powb2 appears in SCOP 1.63
  
• d1powb2 appears in the current release, SCOPe 2.08