Lineage for d5ew0b_ (5ew0 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231217Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2231369Protein automated matches [190079] (9 species)
    not a true protein
  7. 2231480Species Serratia fonticola [TaxId:47917] [196325] (3 PDB entries)
  8. 2231484Domain d5ew0b_: 5ew0 B: [317984]
    automated match to d3sd9a_
    complexed with 3c7, zn

Details for d5ew0b_

PDB Entry: 5ew0 (more details), 1.3 Å

PDB Description: crystal structure of the metallo-beta-lactamase sfh-i in complex with the bisthiazolidine inhibitor l-cs319
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5ew0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ew0b_ d.157.1.1 (B:) automated matches {Serratia fonticola [TaxId: 47917]}
nltlthfkgplyivedkeyvqensmvyigtdgitiigatwtpetaetlykeirkvsplpi
nevintnyhtdraggnaywktlgakivatqmtydlqksqwgsivnftrqgnnkypnleks
lpdtvfpgdfnlqngsiramylgeahtkdgifvyfpaervlygncilkenlgnmsfanrt
eypktleklkglieqgelkvdsiiaghdtpihdvglidhyltllekap

SCOPe Domain Coordinates for d5ew0b_:

Click to download the PDB-style file with coordinates for d5ew0b_.
(The format of our PDB-style files is described here.)

Timeline for d5ew0b_: