SCOPe 2.06: Domain d5ew0b_: 5ew0 B:

Lineage for d5ew0b_ (5ew0 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (9 species)
   not a true protein

7. Species Serratia fonticola [TaxId:47917] [196325] (3 PDB entries)

8. Domain d5ew0b_: 5ew0 B: [317984]
   automated match to d3sd9a_
   complexed with 3c7, zn

Details for d5ew0b_

PDB Entry: 5ew0, 1.3 Å

PDB Description: crystal structure of the metallo-beta-lactamase sfh-i in complex with the bisthiazolidine inhibitor l-cs319

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5ew0b_:

Sequence; same for both SEQRES and ATOM records:

>d5ew0b_ d.157.1.1 (B:) automated matches {Serratia fonticola [TaxId: 47917]}
nltlthfkgplyivedkeyvqensmvyigtdgitiigatwtpetaetlykeirkvsplpi
nevintnyhtdraggnaywktlgakivatqmtydlqksqwgsivnftrqgnnkypnleks
lpdtvfpgdfnlqngsiramylgeahtkdgifvyfpaervlygncilkenlgnmsfanrt
eypktleklkglieqgelkvdsiiaghdtpihdvglidhyltllekap

Timeline for d5ew0b_:

• d5ew0b_ is new in SCOPe 2.06-stable
  
• d5ew0b_ appears in SCOPe 2.07
  
• d5ew0b_ appears in the current release, SCOPe 2.08