SCOPe 2.08: Domain d5czxd2: 5czx D:107-213

Lineage for d5czxd2 (5czx D:107-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5czxd2: 5czx D:107-213 [317982]
   Other proteins in same PDB: d5czxc_, d5czxd1, d5czxh_, d5czxl1
   automated match to d1dn0a2
   complexed with ca, cl, edo, nag

Details for d5czxd2

PDB Entry: 5czx, 2.1 Å

PDB Description: crystal structure of notch3 nrr in complex with 20358 fab

PDB Compounds: (D:) 20358 Fab light chain

SCOPe Domain Sequences for d5czxd2:

Sequence; same for both SEQRES and ATOM records:

>d5czxd2 b.1.1.2 (D:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d5czxd2:

• d5czxd2 first appeared in SCOPe 2.06
  
• d5czxd2 appears in SCOPe 2.07